PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009124666.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 821aa    MW: 91321.3 Da    PI: 5.62
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009124666.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.3e-29546596252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  XP_009124666.1 546 EKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 596
                     79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.45535616IPR003035RWP-RK domain
PfamPF020422.7E-26548596IPR003035RWP-RK domain
SuperFamilySSF542777.29E-21708806No hitNo description
SMARTSM006662.0E-23717803IPR000270PB1 domain
PROSITE profilePS5174519.789717803IPR000270PB1 domain
CDDcd064075.01E-33718802No hitNo description
Gene3DG3DSA:3.10.20.2402.0E-25718803No hitNo description
PfamPF005641.2E-17718802IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
MELDDLDLGS SWPLDQISFA SSNFRFPSSD QPFSPLWSFS SADGGAGELC SAPTLLTDYS  60
LLLASSESET ATKDNHLLPS PSWGVQMPLE NPDTYCAIKA KMTQALRFFK ESTGQQHLLA  120
QVWAPVKNRN GRYLLTTSGQ PFFLGPNSNG LNQYRMVSLT YMFSLDSERD GELGLPGRVF  180
RKKLPEWTPN VQYYSSKEFS RLGHALNYNV QGTLALPVFE PSRQLCVGVV ELIMTSPKIN  240
YAPEVEKVCK ALEAVNLKTS EILNPESTQI CNEGRQNALA EILEILTVVC ETYKLPLAQT  300
WVPCRHRSVL AFGGGFKKSC SSFDGSCMGK VCMSTSDLAV YVVDAHVWGF RDACAEHHLQ  360
KGQGVAGRAF LSGNLCFSRD VTRFCKTDYP LVHYARMFKL TSCFAVCLKS TYTGDDEYVL  420
EFFLPPGVTD EGEQDSLLGS LFQTMKQHYS SLKVVSGTEL FENEMSIEVV EASEDGMVYS  480
KREPIQISIS KDYLELNAPE EKLSLNPDLV ENNEVANGFE RFQTVNPSPE EAKTEKKTER  540
KRGKTEKTIS LEVLQQYFAG SLKDAAKSLG VCPTTMKRIC RQHGISRWPS RKINKVNRSL  600
TRLKHVIDSV QGADGSINLT SLSPRPWQVS QPPPPTTGSP TNYIKLENRD AEDSAGSSTS  660
RASCKVSPIS ETRFRLLTQN QEAFKQTAFD ESDSTSKNIA NFWTSQDTTT LLHNNKLVSI  720
KATYREDIIR FKISPESISI AELKEQVAKR LKLETGAFEL KYLDDDKEWV SVSCDADLSE  780
CLDTSSVVTA AKANTLRLSV HDVTPNFGSS CESSEETMMC L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009124666.10.0PREDICTED: protein NLP6
SwissprotQ8RWY40.0NLP6_ARATH; Protein NLP6
TrEMBLM4FII50.0M4FII5_BRARP; Uncharacterized protein
STRINGBra040914.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25072666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein